PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0926s0053.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 253aa    MW: 28743 Da    PI: 10.1232
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0926s0053.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer894.6e-2857111358
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                          +++Y+eC+kNhAa  Ggh+vDGC+Ef++  geegt  alkCaAC+CHR+FHR+ev 
  Cagra.0926s0053.1.p  57 AAKYRECQKNHAALSGGHVVDGCCEFLAG-GEEGTLGALKCAACNCHRSFHRKEVY 111
                          689*************************8.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.9E-2658110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.7E-2559110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1559110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.85360109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.82E-18173246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-26178246IPR009057Homeodomain-like
PROSITE profilePS500719.021183247IPR001356Homeobox domain
TIGRFAMsTIGR015652.3E-25185242IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MELGGRVQDN AITSTTMIST EVKALTKPYQ DPEAKPESDL SIALFPIKKP KTRVDQAAKY  60
RECQKNHAAL SGGHVVDGCC EFLAGGEEGT LGALKCAACN CHRSFHRKEV YGHKQDQMMI  120
TPAFYSSNNS SYKAMQPRGV YPAGEIGRRT SSSSEDMKKI LSHRNHNNVD GNGMMVTMMM  180
TRKKKKRVRT KINEEQKEKM KEFAERLGWR MQKKDEEEID KFCKVVNLRR QVFKVWMHNN  240
KQAMKRNSNT SD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-191862431875ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181186RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1756491e-169AK175649.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-13-N07.
GenBankAL0498621e-169AL049862.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F18B3.
GenBankAY0860201e-169AY086020.1 Arabidopsis thaliana clone 20695 mRNA, complete sequence.
GenBankCP0026861e-169CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291743.11e-177hypothetical protein CARUB_v10017911mg
SwissprotQ9SVL01e-135ZHD7_ARATH; Zinc-finger homeodomain protein 7
TrEMBLR0FR261e-177R0FR26_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__1433__AT3G50890.11e-138(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138541525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50890.11e-122homeobox protein 28